Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB), Biotinylated

This Recombinant Human SH2 domain-containing adapter protein B (SHB), Biotinylated spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcb5 Mouse shRNA Plasmid (Locus ID 77706)
TR519558 1 Kit

Abcb5 Mouse shRNA Plasmid (Locus ID 77706)

Sign In for Pricing
View Details
TRIM72 Antibody - N-terminal region : Biotin (ARP42970_P050-Biotin)
ARP42970_P050-Biotin 100 µL

TRIM72 Antibody - N-terminal region : Biotin (ARP42970_P050-Biotin)

Sign In for Pricing
View Details
PACSIN2, CT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 2) (Azide free) (HRP) discontinued
P1793-05-HRP 200 µL

PACSIN2, CT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
XRCC6 (X-ray Repair Complementing Defective Repair in Chinese hamster Cells 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (MaxLight 650)
MBS6230668-01 0.1 mL

XRCC6 (X-ray Repair Complementing Defective Repair in Chinese hamster Cells 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (MaxLight 650)

Sign In for Pricing
View Details
XRCC6 (X-ray Repair Complementing Defective Repair in Chinese hamster Cells 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (MaxLight 650)
MBS6230668-02 5x 0.1 mL

XRCC6 (X-ray Repair Complementing Defective Repair in Chinese hamster Cells 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (MaxLight 650)

Sign In for Pricing
View Details
RIPK2 antibody
70R-32732 100 ug

RIPK2 antibody

Sign In for Pricing
View Details