Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B), Biotinylated
This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B), Biotinylated spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA
UniProt
Q96PG8
Expression Region
1-261
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15087683 1 Vial
Lentiviral human IMPG2 shRNA (UAS) - Lentiviral human IMPG2 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 