Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial, Biotinylated

This Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial, Biotinylated spans the amino acid sequence from region 30-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1; EC 1.17.4.4; Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1 VKOR MSTP134 MSTP576 UNQ308/PRO351

UniProt

Q9BQB6

Expression Region

30-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delta Sleep Inducing Peptide
GWB-7B689A 1 mg

Delta Sleep Inducing Peptide

Sign In for Pricing
View Details
1,1,1-Trifluoro-6-methyl-2- (trifluoromethyl) -2,4-heptanediol
PC1008123-01 250 mg

1,1,1-Trifluoro-6-methyl-2- (trifluoromethyl) -2,4-heptanediol

Sign In for Pricing
View Details
1,1,1-Trifluoro-6-methyl-2- (trifluoromethyl) -2,4-heptanediol
PC1008123-02 1 g

1,1,1-Trifluoro-6-methyl-2- (trifluoromethyl) -2,4-heptanediol

Sign In for Pricing
View Details
Dog OPG (Osteoprotegerin) ELISA Kit
MBS8807258-01 48 Well

Dog OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details
Dog OPG (Osteoprotegerin) ELISA Kit
MBS8807258-02 96 Well

Dog OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details
Dog OPG (Osteoprotegerin) ELISA Kit
MBS8807258-03 5x 96 Well

Dog OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details