Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial, Biotinylated

This Recombinant Human Selenoprotein S (SELS), partial, Biotinylated spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium voltage-gated channel subfamily A member 4 (KCNA4) Rat ELISA Kit
G0196 96 Tests

Potassium voltage-gated channel subfamily A member 4 (KCNA4) Rat ELISA Kit

Sign In for Pricing
View Details
SUZ12 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-52749R-BF594-01 20 µL

SUZ12 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
SUZ12 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-52749R-BF594-02 100 µL

SUZ12 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ZNF514 Antibody - middle region (ARP36082_P050)
ARP36082_P050 100 µL

ZNF514 Antibody - middle region (ARP36082_P050)

Sign In for Pricing
View Details
Rabbit Polyclonal GM632 Antibody [Alexa Fluor 647]
NBP2-98091AF647 0.1 mL

Rabbit Polyclonal GM632 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
TICAM1 Antibody
orb2682179-01 50 µL

TICAM1 Antibody

Sign In for Pricing
View Details