Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myb-binding protein 1A (MBB1A), partial, Biotinylated

This Recombinant Human Myb-binding protein 1A (MBB1A), partial, Biotinylated spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myb-binding protein 1A MYBBP1A P160

UniProt

Q9BQG0

Expression Region

1-500

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEYLRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFSDENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWPASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFLEGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLDSLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCLFHSFFVTKKPTSQIPETKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD6 Rabbit Polyclonal Antibody
TA371956 100 µL

ABHD6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sulfamerazine-d4
TRC-S689002-1MG 1 mg

Sulfamerazine-d4

Sign In for Pricing
View Details
GRK6 (NM_002082) Human Over-expression Lysate
LY419550 100 µg

GRK6 (NM_002082) Human Over-expression Lysate

Sign In for Pricing
View Details
DLX4 (NM_138281) Human Over-expression Lysate
LC403346 20 µg

DLX4 (NM_138281) Human Over-expression Lysate

Sign In for Pricing
View Details
BRSK1 Antibody (pThr189): FITC
SPC-927D-FITC 100 µL

BRSK1 Antibody (pThr189): FITC

Sign In for Pricing
View Details
Recombinant Human Interleukin-17F/IL-17F Protein
PKSH032622-01 20 µg

Recombinant Human Interleukin-17F/IL-17F Protein

Sign In for Pricing
View Details