Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial, Biotinylated

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial, Biotinylated spans the amino acid sequence from region 1-77. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 2; 3'-phosphoadenosine 5'-phosphosulfate transporter; PAPS transporter 2; Solute carrier family 35 member B3; SLC35B3 C6orf196 PAPST2 CGI-19

UniProt

Q9H1N7

Expression Region

1-77

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gastrokine 2 (GKN2) activation kit by CRISPRa
GA116351 1 Kit

Human Gastrokine 2 (GKN2) activation kit by CRISPRa

Sign In for Pricing
View Details
CNDP2 Mouse Monoclonal Antibody [Clone ID: AT15E5]
AM50023PU-S 50 µL

CNDP2 Mouse Monoclonal Antibody [Clone ID: AT15E5]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Alkaline Phosphatase,  40nm
GM-504-40 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Alkaline Phosphatase, 40nm

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL
BNC882054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trefoil Factor 3 (TFF3) Mouse Monoclonal Antibody [Clone ID: OTI5B2]
CF811442 100 µg

Trefoil Factor 3 (TFF3) Mouse Monoclonal Antibody [Clone ID: OTI5B2]

Sign In for Pricing
View Details
Dynamin-1 (Ab-774) Antibody
8B0422-AAT 50 µg

Dynamin-1 (Ab-774) Antibody

Sign In for Pricing
View Details