Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial, Biotinylated

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial, Biotinylated spans the amino acid sequence from region 1-77. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 2; 3'-phosphoadenosine 5'-phosphosulfate transporter; PAPS transporter 2; Solute carrier family 35 member B3; SLC35B3 C6orf196 PAPST2 CGI-19

UniProt

Q9H1N7

Expression Region

1-77

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H8 antibody
FNab09605 100 µg

ZC3H8 antibody

Sign In for Pricing
View Details
CD20 (MS4A1) (NM_021950) Human Over-expression Lysate
LC402889 20 µg

CD20 (MS4A1) (NM_021950) Human Over-expression Lysate

Sign In for Pricing
View Details
MRTFA Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF805203 100 µg

MRTFA Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Sign In for Pricing
View Details
TREM1 (NM_018643) Human Over-expression Lysate
LY402700 100 µg

TREM1 (NM_018643) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome P450 2E1 (CYP2E1) (C-term) Rabbit Polyclonal Antibody
AP23325PU-N 100 µg

Cytochrome P450 2E1 (CYP2E1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chk1 (CHEK1) Rabbit Polyclonal Antibody
AP21018PU-N 100 µg

Chk1 (CHEK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details