Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleolar protein 12 (NOL12), Biotinylated

This Recombinant Human Nucleolar protein 12 (NOL12), Biotinylated spans the amino acid sequence from region 1-213. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleolar protein 12 NOL12

UniProt

Q9UGY1

Expression Region

1-213

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methylmalonic acid-D3
DE2075 1 Each

Methylmalonic acid-D3

Sign In for Pricing
View Details
ABLIM1 (Actin-binding LIM Protein 1, abLIM-1, Actin-binding LIM Protein Family Member 1, Actin-binding Double Zinc Finger Protein, LIMAB1, Limatin, ABLIM, KIAA0059, DKFZp781D0148, FLJ14564, MGC1224)
122831 100 µg

ABLIM1 (Actin-binding LIM Protein 1, abLIM-1, Actin-binding LIM Protein Family Member 1, Actin-binding Double Zinc Finger Protein, LIMAB1, Limatin, ABLIM, KIAA0059, DKFZp781D0148, FLJ14564, MGC1224)

Sign In for Pricing
View Details
Canine Hyaluronic Acid ELISA kit
GTR10449044 96 Well

Canine Hyaluronic Acid ELISA kit

Sign In for Pricing
View Details
Ethyl 3- (1-methylpropoxy) benzoate
OR1081743-01 250 mg

Ethyl 3- (1-methylpropoxy) benzoate

Sign In for Pricing
View Details
Ethyl 3- (1-methylpropoxy) benzoate
OR1081743-02 500 mg

Ethyl 3- (1-methylpropoxy) benzoate

Sign In for Pricing
View Details
Ethyl 3- (1-methylpropoxy) benzoate
OR1081743-03 1 g

Ethyl 3- (1-methylpropoxy) benzoate

Sign In for Pricing
View Details