Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated

This Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCS1 (NM_001098272) Human Recombinant Protein
TP324071L 1 mg

HMGCS1 (NM_001098272) Human Recombinant Protein

Sign In for Pricing
View Details
PTBP1 Human Knockdown Lysate
LY300408 100 µg

PTBP1 Human Knockdown Lysate

Sign In for Pricing
View Details
Penconazole-d7
TRC-P221803-2.5MG 2.5 mg

Penconazole-d7

Sign In for Pricing
View Details
Anti-LUX | Transcription factor LUX
AS16 4106 50 µg

Anti-LUX | Transcription factor LUX

Sign In for Pricing
View Details
Abca4 Mouse Gene Knockout Kit (CRISPR)
KN500605 1 Kit

Abca4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1X Tris-EDTA (TE) Buffer, pH7.5, Ultra Pure Grade, 500ml
PB1214-500ml 500 mL

1X Tris-EDTA (TE) Buffer, pH7.5, Ultra Pure Grade, 500ml

Sign In for Pricing
View Details