Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated

This Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHA + LDHB Recombinant Rabbit monoclonal Antibody
HA723486 100 µL

LDHA + LDHB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Il18 Rabbit Polyclonal Antibody
TA377435 100 µL

Il18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tide Quencher™ 2WS alkyne [TQ2WS alkyne]
2213-AAT 1 mg

Tide Quencher™ 2WS alkyne [TQ2WS alkyne]

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF640R conjugate, 0.1mg/mL
BNC402466-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM21 Antibody
KC-812-01 50 μL

TRIM21 Antibody

Sign In for Pricing
View Details
TRIM21 Antibody
KC-812-02 100 µL

TRIM21 Antibody

Sign In for Pricing
View Details