Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated

This Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 490)
253712-ML490 100 µL

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 490)

Sign In for Pricing
View Details
Adenosine A2b Receptor (A2b)
MBS610342-01 0.1 mg

Adenosine A2b Receptor (A2b)

Sign In for Pricing
View Details
Adenosine A2b Receptor (A2b)
MBS610342-02 5x 0.1 mg

Adenosine A2b Receptor (A2b)

Sign In for Pricing
View Details
Rabbit Polyclonal PSMG3 Antibody [DyLight 488]
NBP2-97973G 0.1 mL

Rabbit Polyclonal PSMG3 Antibody [DyLight 488]

Sign In for Pricing
View Details
Mouse LpPLA2/PLA2G7/PAF-AH Recombinant Protein (C-Fc)
MC293011-01 50 µg

Mouse LpPLA2/PLA2G7/PAF-AH Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse LpPLA2/PLA2G7/PAF-AH Recombinant Protein (C-Fc)
MC293011-02 100 µg

Mouse LpPLA2/PLA2G7/PAF-AH Recombinant Protein (C-Fc)

Sign In for Pricing
View Details