Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial, Biotinylated

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial, Biotinylated spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Flex: Equine IFN-γ (HRP)
3117-1H-6 For 6 Plates

ELISA Flex: Equine IFN-γ (HRP)

Sign In for Pricing
View Details
Human ANGPTL3 (243-460) Protein
orb424085-01 5 µg

Human ANGPTL3 (243-460) Protein

Sign In for Pricing
View Details
Human ANGPTL3 (243-460) Protein
orb424085-02 20 µg

Human ANGPTL3 (243-460) Protein

Sign In for Pricing
View Details
Human ANGPTL3 (243-460) Protein
orb424085-03 1 mg

Human ANGPTL3 (243-460) Protein

Sign In for Pricing
View Details
D-Arginyl-[Hyp3, Thi5, D-Tic7, Oic8] -Bradykinin
4293-v 0.5 mg

D-Arginyl-[Hyp3, Thi5, D-Tic7, Oic8] -Bradykinin

Sign In for Pricing
View Details
FASTK Rabbit pAb
E45R27078N 50 ul

FASTK Rabbit pAb

Sign In for Pricing
View Details