Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4), Biotinylated

This Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4), Biotinylated spans the amino acid sequence from region 1-619. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase DTX4; EC 2.3.2.27; Protein deltex-4; Deltex4; RING finger protein 155; RING-type E3 ubiquitin transferase DTX4; DTX4 KIAA0937 RNF155

UniProt

Q9Y2E6

Expression Region

1-619

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurokinin B
MBS405841-01 0.5 mg

Neurokinin B

Sign In for Pricing
View Details
Neurokinin B
MBS405841-02 25 mg

Neurokinin B

Sign In for Pricing
View Details
Neurokinin B
MBS405841-03 5x 25 mg

Neurokinin B

Sign In for Pricing
View Details
RNASEH2B (Ribonuclease H2 Subunit B)
490618 100 µL

RNASEH2B (Ribonuclease H2 Subunit B)

Sign In for Pricing
View Details
FBXW11 (F-box/WD Repeat-Containing Protein , 11, F-Box and WD Repeat Domain Containing 11)
480943 100 µL

FBXW11 (F-box/WD Repeat-Containing Protein , 11, F-Box and WD Repeat Domain Containing 11)

Sign In for Pricing
View Details
(S)-Styrene Glycol
TRC-S687820-25G 25 g

(S)-Styrene Glycol

Sign In for Pricing
View Details