Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Guanylate Cyclase 1β3
GTR10443839 96 Well

Monkey Guanylate Cyclase 1β3

Sign In for Pricing
View Details
Ethyl 2-amino-2- (oxan-3-yl) acetate hydrochloride
THC97975-01 50 mg

Ethyl 2-amino-2- (oxan-3-yl) acetate hydrochloride

Sign In for Pricing
View Details
Ethyl 2-amino-2- (oxan-3-yl) acetate hydrochloride
THC97975-02 0.5 g

Ethyl 2-amino-2- (oxan-3-yl) acetate hydrochloride

Sign In for Pricing
View Details
Goat anti Mouse Serum proteins , conjugated with FITC
GAM/TSP/FITC 1 mL

Goat anti Mouse Serum proteins , conjugated with FITC

Sign In for Pricing
View Details
PLAG1 shRNA Plasmid (m)
sc-38180-SH 20 µg

PLAG1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Influenza B (B/PHUKET/3073/2013) Hemagglutinin / HA1 Protein (His Tag)
PO54583M2 100 µg

Influenza B (B/PHUKET/3073/2013) Hemagglutinin / HA1 Protein (His Tag)

Sign In for Pricing
View Details