Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACF, CT (A1CF, ACF, ASP, APOBEC1 complementation factor, APOBEC1-stimulating protein) (Azide free) (HRP)
MBS6270929-01 0.2 mL

ACF, CT (A1CF, ACF, ASP, APOBEC1 complementation factor, APOBEC1-stimulating protein) (Azide free) (HRP)

Sign In for Pricing
View Details
ACF, CT (A1CF, ACF, ASP, APOBEC1 complementation factor, APOBEC1-stimulating protein) (Azide free) (HRP)
MBS6270929-02 5x 0.2 mL

ACF, CT (A1CF, ACF, ASP, APOBEC1 complementation factor, APOBEC1-stimulating protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal SCAF8/RBM16 Antibody
NBP3-05864-100ul 100 µL

Rabbit Polyclonal SCAF8/RBM16 Antibody

Sign In for Pricing
View Details
DLG2 Antibody, FITC conjugated
A55520-50UG 50 µg

DLG2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lass5 (CERS5) Human Gene Knockout Kit (CRISPR)
KN207649 1 Kit

Lass5 (CERS5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zaurategrast ethyl ester
MBS3845066-01 5 mg

Zaurategrast ethyl ester

Sign In for Pricing
View Details