Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Neuropilin 1 Antibody Picoband® (monoclonal, 4G3F7) (Dylight488 Conjugate)
M01324-1-Dylight488 100 µg

Anti-Neuropilin 1 Antibody Picoband® (monoclonal, 4G3F7) (Dylight488 Conjugate)

Sign In for Pricing
View Details
L-type Ca++ CP α1D shRNA (h) Lentiviral Particles
sc-42690-V 200 µL

L-type Ca++ CP α1D shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Hnrnpa1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3930206 1.0 µg DNA

Hnrnpa1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Catenin gamma Blocking Peptide
MBS9625524-01 1 mg

Catenin gamma Blocking Peptide

Sign In for Pricing
View Details
Catenin gamma Blocking Peptide
MBS9625524-02 5x 1 mg

Catenin gamma Blocking Peptide

Sign In for Pricing
View Details
CD8A siRNA (Mouse)
MBS829486-01 15 nmol

CD8A siRNA (Mouse)

Sign In for Pricing
View Details