Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prokaryotic Human Autophagy Related Protein 7
RPU57706-01 50 µg

Prokaryotic Human Autophagy Related Protein 7

Sign In for Pricing
View Details
Prokaryotic Human Autophagy Related Protein 7
RPU57706-02 100 µg

Prokaryotic Human Autophagy Related Protein 7

Sign In for Pricing
View Details
Prokaryotic Human Autophagy Related Protein 7
RPU57706-03 1 mg

Prokaryotic Human Autophagy Related Protein 7

Sign In for Pricing
View Details
Biotinylated Influenza A virus (A/Victoria/4897/2022) NA (H1N1) Protein, Avitag™, His Tag
NEE-V82Q3-200ug 200 µg

Biotinylated Influenza A virus (A/Victoria/4897/2022) NA (H1N1) Protein, Avitag™, His Tag

Sign In for Pricing
View Details
Prohibitin Lentiviral Activation Particles (m)
sc-422218-LAC 200 µL

Prohibitin Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
OOCA01272-25T - Human PHGDH Primer Pair 2
OOCA01272-25T 25 Tests

OOCA01272-25T - Human PHGDH Primer Pair 2

Sign In for Pricing
View Details