Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated
This Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated spans the amino acid sequence from region 895-1007. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fanconi-associated nuclease 1; EC 3.1.21.-; EC 3.1.4.1; FANCD2/FANCI-associated nuclease 1; hFAN1; Myotubularin-related protein 15; FAN1 KIAA1018 MTMR15
UniProt
Q9Y2M0
Expression Region
895-1007
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
EESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
328963-01 50 µg
MRE11, phosphorylated (S264) (MRE11A, HNGS1, Double-strand break repair protein MRE11A, Meiotic recombination 11 homolog 1, MRE11 homolog 1, Meiotic recombination 11 homolog A, MRE11 homolog A)
Sign In for Pricing
View Details