Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tyrosine-protein phosphatase non-receptor type 22 (PTN22), partial, Biotinylated

This Recombinant Human Tyrosine-protein phosphatase non-receptor type 22 (PTN22), partial, Biotinylated spans the amino acid sequence from region 24-289. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tyrosine-protein phosphatase non-receptor type 22; EC 3.1.3.48; Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; Lymphoid phosphatase; LyP; PEST-domain phosphatase; PEP; PTPN22 PTPN8

UniProt

Q9Y2R2

Expression Region

24-289

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-100 1x 100 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL
BNC682227-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details