Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2), Biotinylated
This Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
U6 snRNA-associated Sm-like protein LSm2; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5; LSM2 C6orf28 G7B
UniProt
Q9Y333
Expression Region
1-95
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog