Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31), Biotinylated

This Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31), Biotinylated spans the amino acid sequence from region 2-131. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mediator of RNA polymerase II transcription subunit 31; Mediator complex subunit 31; Mediator complex subunit SOH1; hSOH1; MED31 SOH1 CGI-125

UniProt

Q9Y3C7

Expression Region

2-131

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), 0.2mg/mL
BNUB0965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), 0.2mg/mL

Sign In for Pricing
View Details
P53 (DO-7), CF568 conjugate, 0.1mg/mL
BNC680513-100 1x 100 µL

P53 (DO-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details