Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial, Biotinylated
This Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial, Biotinylated spans the amino acid sequence from region 38-179. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Peptidyl-tRNA hydrolase 2, mitochondrial; PTH 2; EC 3.1.1.29; Bcl-2 inhibitor of transcription 1; PTRH2 BIT1 PTH2 CGI-147
UniProt
Q9Y3E5
Expression Region
38-179
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-289461A 250 mg
4- (3-Carboxy-pyridin-2-yl) piperazine-1-carboxylic acid tert-butyl ester
Sign In for Pricing
View Details 
050401-01 10 µg
Vascular Endothelial Growth Factor B (VEGFB), Recombinant, Bovine, His-Tag
Sign In for Pricing
View Details 050401-02 50 µg
Vascular Endothelial Growth Factor B (VEGFB), Recombinant, Bovine, His-Tag
Sign In for Pricing
View Details 050401-03 100 µg
Vascular Endothelial Growth Factor B (VEGFB), Recombinant, Bovine, His-Tag
Sign In for Pricing
View Details