Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Human Gene Knockout Kit (CRISPR)
KN202922LP 1 Kit

CD19 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4 crank/ Manual 5 function medical bed BHBD-418
BHBD-418 1 Unit

4 crank/ Manual 5 function medical bed BHBD-418

Sign In for Pricing
View Details
PRAK (MAPKAPK5) pSer93 Rabbit Polyclonal Antibody
AP12637PU-N 400 µL

PRAK (MAPKAPK5) pSer93 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802929 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PPAR gamma (PPARG) (Isoform 1) (255 -268) Rabbit Polyclonal Antibody
AP07824PU-N 50 µg

PPAR gamma (PPARG) (Isoform 1) (255 -268) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF647 conjugate, 0.1mg/mL
BNC471060-500 1x 500 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details