Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HighRanger 1kb DNA Ladder
11900 100 Loads

HighRanger 1kb DNA Ladder

Sign In for Pricing
View Details
Melanoma Marker (PNL2), 1mg/mL
BNUM0894-50 1x 50 µL

Melanoma Marker (PNL2), 1mg/mL

Sign In for Pricing
View Details
Fluorescent Brightener 134 (Technical Grade)
TRC-F597825-50MG 50 mg

Fluorescent Brightener 134 (Technical Grade)

Sign In for Pricing
View Details
Human PREX1 activation kit by CRISPRa
GA111607 1 Kit

Human PREX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details