Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF702 (NM_024924) Human Tagged ORF Clone
RG207462 10 µg

ZNF702 (NM_024924) Human Tagged ORF Clone

Sign In for Pricing
View Details
N-Demethylricinine
BUP16571 100 mg

N-Demethylricinine

Sign In for Pricing
View Details
FAM19A2 siRNA (Human)
MBS8225556-01 15 nmol

FAM19A2 siRNA (Human)

Sign In for Pricing
View Details
FAM19A2 siRNA (Human)
MBS8225556-02 30 nmol

FAM19A2 siRNA (Human)

Sign In for Pricing
View Details
FAM19A2 siRNA (Human)
MBS8225556-03 5x 30 nmol

FAM19A2 siRNA (Human)

Sign In for Pricing
View Details
SLC7A3 (FITC)
577031-01 50 µg

SLC7A3 (FITC)

Sign In for Pricing
View Details