Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (APC)
138362-APC 100 µL

SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (APC)

Sign In for Pricing
View Details
6-O- (Triphenylmethyl) -D-glucopyranose Tetraacetate
438851-01 5 g

6-O- (Triphenylmethyl) -D-glucopyranose Tetraacetate

Sign In for Pricing
View Details
6-O- (Triphenylmethyl) -D-glucopyranose Tetraacetate
438851-02 25 g

6-O- (Triphenylmethyl) -D-glucopyranose Tetraacetate

Sign In for Pricing
View Details
CtBP1 (Ab-422) Antibody
orb193183-01 50 μL

CtBP1 (Ab-422) Antibody

Sign In for Pricing
View Details
CtBP1 (Ab-422) Antibody
orb193183-02 100 µL

CtBP1 (Ab-422) Antibody

Sign In for Pricing
View Details
Cyp2d3 (NM_173093) Rat Tagged ORF Clone Lentiviral Particle
RR206627L3V 200 µL

Cyp2d3 (NM_173093) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details