Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Methyl-1H,6H,7H-pyrrolo[2,3-c]pyridin-7-one
EEC95102-01 50 mg

5-Methyl-1H,6H,7H-pyrrolo[2,3-c]pyridin-7-one

Sign In for Pricing
View Details
5-Methyl-1H,6H,7H-pyrrolo[2,3-c]pyridin-7-one
EEC95102-02 0.5 g

5-Methyl-1H,6H,7H-pyrrolo[2,3-c]pyridin-7-one

Sign In for Pricing
View Details
Fer1l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3088006 1.0 µg DNA

Fer1l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody
MBS9437033-01 0.1 mL (Biotin)

NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody
MBS9437033-02 0.1 mL (AF350)

NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody
MBS9437033-03 0.1 mL (AF405)

NFkappaB-p65 (Phospho-Thr505) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details