Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial, Biotinylated spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lect1 ELISA Kit
EF018907 96 Tests

Rat Lect1 ELISA Kit

Sign In for Pricing
View Details
Tulp1 ORF Vector (Mouse) (pORF)
48840014 1.0 µg DNA

Tulp1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ENPP6 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13076R-APC-Cy5.5 100 µL

ENPP6 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
H2ax Rabbit Polyclonal Antibody
TA362993 100 µL

H2ax Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-CENPM Polyclonal Antibody
PAV801 100 μL

Rabbit Anti-CENPM Polyclonal Antibody

Sign In for Pricing
View Details
PPV VP2 Rabbit pAb, AP conjugated
orb2843704 100 µL

PPV VP2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details