Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial, Biotinylated

This Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial, Biotinylated spans the amino acid sequence from region 273-341. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 10 subunit alpha; Peripheral nerve sodium channel 3; PN3; hPN3; Sodium channel protein type X subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.8; SCN10A

UniProt

Q9Y5Y9

Expression Region

273-341

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNKCVKNDMAVNETTNYSSHRKPDIYINKRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM50A Protein Vector (Mouse) (pPM-C-HA)
47060024 500 ng

TMEM50A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PBX2 (G17, Pre-B-cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17)
MBS643742-01 0.1 mL

PBX2 (G17, Pre-B-cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17)

Sign In for Pricing
View Details
PBX2 (G17, Pre-B-cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17)
MBS643742-02 5x 0.1 mL

PBX2 (G17, Pre-B-cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17)

Sign In for Pricing
View Details
SOX18 Antibody - middle region : FITC (ARP33057_T100-FITC)
ARP33057_T100-FITC 100 µL

SOX18 Antibody - middle region : FITC (ARP33057_T100-FITC)

Sign In for Pricing
View Details
TIGAR, NT (TIGAR, C12orf5, Fructose-2,6-bisphosphatase TIGAR, TP53-induced glycolysis and apoptosis regulator) (PE) discontinued
042832-PE 200 µL

TIGAR, NT (TIGAR, C12orf5, Fructose-2,6-bisphosphatase TIGAR, TP53-induced glycolysis and apoptosis regulator) (PE) discontinued

Sign In for Pricing
View Details
Complement 4d (C4d) (Acute Humoral Rejection Marker) Antibody
orb1712469 0.5 mL

Complement 4d (C4d) (Acute Humoral Rejection Marker) Antibody

Sign In for Pricing
View Details