Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial, Biotinylated

This Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial, Biotinylated spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UbiA prenyltransferase domain-containing protein 1; EC 2.5.1.-; EC 2.5.1.39; Transitional epithelial response protein 1; UBIAD1 TERE1

UniProt

Q9Y5Z9

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIP2A ELISA Kit (Human) (OKDD00191)
OKDD00191 96 Well

CIP2A ELISA Kit (Human) (OKDD00191)

Sign In for Pricing
View Details
Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody
MBS2544254-01 0.06 mL

Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody
MBS2544254-02 0.12 mL

Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody
MBS2544254-03 0.2 mL

Rabbit anti Human GBA3/CBGL1  Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS, iRFP) (100)
GTR15209979 1 Vial

Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Brd9 ORF Vector (Mouse) (pORF)
13470014 1.0 µg DNA

Brd9 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details