Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-4 (MYH4), partial, Biotinylated

This Recombinant Human Myosin-4 (MYH4), partial, Biotinylated spans the amino acid sequence from region 86-782. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-4; Myosin heavy chain 2b; MyHC-2b; Myosin heavy chain 4; Myosin heavy chain IIb; MyHC-IIb; Myosin heavy chain, skeletal muscle, fetal; MYH4

UniProt

Q9Y623

Expression Region

86-782

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS, RFP) (25)
GTR15086327 1 Vial

Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human CCT3 shRNA (UAS) - Lentiviral human CCT3 shRNA (UAS, iRFP) (25)
GTR15315857 1 Vial

Lentiviral human CCT3 shRNA (UAS) - Lentiviral human CCT3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
EGFL5 CRISPR Activation Plasmid (m2)
sc-432935-ACT-2 20 µg

EGFL5 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Ppp4r3a (NM_211355) Mouse Untagged Clone
MC221838 10 µg

Ppp4r3a (NM_211355) Mouse Untagged Clone

Sign In for Pricing
View Details
Hamster Extracellular Glycoprotein Lacritin (LACRT) ELISA Kit
MBS9930645-01 48 Well

Hamster Extracellular Glycoprotein Lacritin (LACRT) ELISA Kit

Sign In for Pricing
View Details
Hamster Extracellular Glycoprotein Lacritin (LACRT) ELISA Kit
MBS9930645-02 96 Well

Hamster Extracellular Glycoprotein Lacritin (LACRT) ELISA Kit

Sign In for Pricing
View Details