Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial, Biotinylated

This Recombinant Human Selenoprotein K (SELK), partial, Biotinylated spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMNL1 Conjugated Antibody
orb1621541 100 µL

FMNL1 Conjugated Antibody

Sign In for Pricing
View Details
SYT3 Blocking Peptide
33R-9832 100 ug

SYT3 Blocking Peptide

Sign In for Pricing
View Details
LRRC49 siRNA Oligos set (Human)
27678171 3x 5 nmol

LRRC49 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Inhba activation kit by CRISPRa
GA202165 1 Kit

Mouse Inhba activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
15297064 1.0 µg DNA

CCDC7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Daam2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3661007 1.0 µg DNA

Daam2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details