Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 264 (TX264), partial, Biotinylated

This Recombinant Human Testis-expressed protein 264 (TX264), partial, Biotinylated spans the amino acid sequence from region 32-313. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 264; Putative secreted protein Zsig11; TEX264 ZSIG11 UNQ337/PRO536

UniProt

Q9Y6I9

Expression Region

32-313

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC2 Rabbit Polyclonal Antibody
TA323157 100 µL

HDAC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monkey HO1 ELISA Kit
EMKH0101 96 Tests

Monkey HO1 ELISA Kit

Sign In for Pricing
View Details
GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)
APR27037N-01 50 µL

GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)

Sign In for Pricing
View Details
GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)
APR27037N-02 100 µL

GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)

Sign In for Pricing
View Details
GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)
APR27037N-03 200 µL

GITR Ligand/TNFSF18 Rabbit pAb (APR27037N)

Sign In for Pricing
View Details
USP38 Conjugated Antibody
C35122 100 µL

USP38 Conjugated Antibody

Sign In for Pricing
View Details