Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-cis-Retinal
TRC-R239850-25MG 25 mg

9-cis-Retinal

Sign In for Pricing
View Details
Medium Binding 96 well Solid plates - Black PS
MCB0F-MB 50x 96 Well Plates

Medium Binding 96 well Solid plates - Black PS

Sign In for Pricing
View Details
FTCD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]
TA504946BM 100 µL

FTCD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]

Sign In for Pricing
View Details
Transmembrane protein 93 (EMC6) (NM_001014764) Human Over-expression Lysate
LC423076 20 µg

Transmembrane protein 93 (EMC6) (NM_001014764) Human Over-expression Lysate

Sign In for Pricing
View Details
2-(3-Amino-4-chlorobenzoyl)benzoic Acid)
TRC-A603200-5G 5 g

2-(3-Amino-4-chlorobenzoyl)benzoic Acid)

Sign In for Pricing
View Details
TBLR1 (TBL1XR1) Rabbit Monoclonal Antibody
TA423663 100 µL

TBLR1 (TBL1XR1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details