Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasma/Serum Exosome Purification Midi Kit
57500 25 Preparations

Plasma/Serum Exosome Purification Midi Kit

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL
BNC881484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]
AM31356PU-N 2 mL (200 Tests)

Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]

Sign In for Pricing
View Details
Salmonella enterica TaqMan PCR Kit Dx
DxTM32100 24 Reactions

Salmonella enterica TaqMan PCR Kit Dx

Sign In for Pricing
View Details
1-Chlorophthalazine
TRC-C379660-500MG 500 mg

1-Chlorophthalazine

Sign In for Pricing
View Details
(+)-Lupanine Perchlorate
TRC-L474830-1MG 1 mg

(+)-Lupanine Perchlorate

Sign In for Pricing
View Details