Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27), Biotinylated

This Recombinant Human T cell receptor alpha variable 27 (TVA27), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1ra Mouse shRNA Plasmid (Locus ID 50909)
TL519222 1 Kit

C1ra Mouse shRNA Plasmid (Locus ID 50909)

Sign In for Pricing
View Details
ADAM29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
11329061 1.0 µg DNA

ADAM29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse IL-10 ELISA Kit
EM0005 96 Tests

Mouse IL-10 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TAF6L Antibody
NBP2-39083-25ul 25 µL

Rabbit Polyclonal TAF6L Antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)
MBS2097184-01 0.1 mL

Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)
MBS2097184-02 0.2 mL

Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)

Sign In for Pricing
View Details