Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65), Biotinylated

This Recombinant Human T cell receptor beta variable 6-5 (TVB65), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eva1a (NM_145570) Mouse Tagged ORF Clone
MG201175 10 µg

Eva1a (NM_145570) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), Biotin conjugate, 0.1mg/mL
BNCB2905-500 1x 500 µL

CD29 (Stem Cell Marker) (12G10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dowex 50X2-100, Ion-exchange Resin, ACROS Organics
TRC-D126135-5G 5 g

Dowex 50X2-100, Ion-exchange Resin, ACROS Organics

Sign In for Pricing
View Details