Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Junctophilin 2 (JPH2) activation kit by CRISPRa
GA111416 1 Kit

Human Junctophilin 2 (JPH2) activation kit by CRISPRa

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF740 conjugate, 0.1mg/mL
BNC741448-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF568 conjugate, 0.1mg/mL
BNC682057-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details