Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella Multocida thiM Protein (aa 1-267)
VAng-Cr7399-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida thiM Protein (aa 1-267)

Sign In for Pricing
View Details
Human Transcription intermediary factor 1-beta (TRIM28/KAP1/RNF96/TIF1B) ELISA Kit
NSL1384Hu 96 Tests

Human Transcription intermediary factor 1-beta (TRIM28/KAP1/RNF96/TIF1B) ELISA Kit

Sign In for Pricing
View Details
ADAM1B Double Nickase Plasmid (m)
sc-435539-NIC 20 µg

ADAM1B Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit Monoclonal Teplizumab Antibody (2505B) [Alexa Fluor 532]
FAB10245X 0.1 mL

Rabbit Monoclonal Teplizumab Antibody (2505B) [Alexa Fluor 532]

Sign In for Pricing
View Details
Troponin I, Cardiac/Skeletal (Troponin I, cardiac muscle, Cardiac troponin I, TNNI3, TNNC1/Troponin I, slow skeletal muscle, Troponin I, slow-twitch isoform, TNNI1/Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, TNNI2) (PE)
MBS6252246-01 0.1 mL

Troponin I, Cardiac/Skeletal (Troponin I, cardiac muscle, Cardiac troponin I, TNNI3, TNNC1/Troponin I, slow skeletal muscle, Troponin I, slow-twitch isoform, TNNI1/Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, TNNI2) (PE)

Sign In for Pricing
View Details
Troponin I, Cardiac/Skeletal (Troponin I, cardiac muscle, Cardiac troponin I, TNNI3, TNNC1/Troponin I, slow skeletal muscle, Troponin I, slow-twitch isoform, TNNI1/Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, TNNI2) (PE)
MBS6252246-02 5x 0.1 mL

Troponin I, Cardiac/Skeletal (Troponin I, cardiac muscle, Cardiac troponin I, TNNI3, TNNC1/Troponin I, slow skeletal muscle, Troponin I, slow-twitch isoform, TNNI1/Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, TNNI2) (PE)

Sign In for Pricing
View Details