Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propiocaine Hydrochloride
TRC-P772500-100MG 100 mg

Propiocaine Hydrochloride

Sign In for Pricing
View Details
Zephirol
TRC-Z343000-10G 10 g

Zephirol

Sign In for Pricing
View Details
Human FGF-2 Recombinant Rabbit Monoclonal Antibody [PSH02-08] - BSA and Azide free (Capture)
HA721780 100 µL

Human FGF-2 Recombinant Rabbit Monoclonal Antibody [PSH02-08] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648057 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details
2-Chloro-1,3-propanediol-d5
TRC-C379693-25MG 25 mg

2-Chloro-1,3-propanediol-d5

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF640R conjugate, 0.1mg/mL
BNC402838-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details