Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial, Biotinylated

This Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial, Biotinylated spans the amino acid sequence from region 332-457. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNK3/IPCEF1 fusion protein CNK3/IPCEF1

UniProt

G9CGD6

Expression Region

332-457

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VTCN1 Protein, N-His
orb3060824-01 50 µg

Recombinant Human VTCN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human VTCN1 Protein, N-His
orb3060824-02 100 µg

Recombinant Human VTCN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human VTCN1 Protein, N-His
orb3060824-03 1 mg

Recombinant Human VTCN1 Protein, N-His

Sign In for Pricing
View Details
TDG (G/T Mismatch-specific Thymine DNA Glycosylase, Thymine-DNA Glycosylase, hTDG) APC
MBS6396237-01 0.1 mL

TDG (G/T Mismatch-specific Thymine DNA Glycosylase, Thymine-DNA Glycosylase, hTDG) APC

Sign In for Pricing
View Details
TDG (G/T Mismatch-specific Thymine DNA Glycosylase, Thymine-DNA Glycosylase, hTDG) APC
MBS6396237-02 5x 0.1 mL

TDG (G/T Mismatch-specific Thymine DNA Glycosylase, Thymine-DNA Glycosylase, hTDG) APC

Sign In for Pricing
View Details
RANBP6 discontinued
513447 100 µg

RANBP6 discontinued

Sign In for Pricing
View Details