Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piercer of microtubule wall 2 protein (PIRC2), Biotinylated

This Recombinant Human Piercer of microtubule wall 2 protein (PIRC2), Biotinylated spans the amino acid sequence from region 1-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Piercer of microtubule wall 2 protein PIERCE2 C15orf65

UniProt

H3BRN8

Expression Region

1-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp7 Mouse Gene Knockout Kit (CRISPR)
KN318814RB 1 Kit

Usp7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS637463 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Recombinant Mouse CRP/C-Reactive protein (His tag)
PDMM100036-01 20 µg

Recombinant Mouse CRP/C-Reactive protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CRP/C-Reactive protein (His tag)
PDMM100036-02 100 µg

Recombinant Mouse CRP/C-Reactive protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CRP/C-Reactive protein (His tag)
PDMM100036-03 500 µg

Recombinant Mouse CRP/C-Reactive protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CRP/C-Reactive protein (His tag)
PDMM100036-04 1 mg

Recombinant Mouse CRP/C-Reactive protein (His tag)

Sign In for Pricing
View Details