Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Benzyloxyindole-3-acetonitrile
B08800 100 mg

5-Benzyloxyindole-3-acetonitrile

Sign In for Pricing
View Details
CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (MaxLight 650)
MBS6372924-01 0.1 mL

CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (MaxLight 650)

Sign In for Pricing
View Details
CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (MaxLight 650)
MBS6372924-02 5x 0.1 mL

CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (MaxLight 650)

Sign In for Pricing
View Details
1-Ethyl-3-methylimidazolium acetate
IL-0189-HP-0500 500 g

1-Ethyl-3-methylimidazolium acetate

Sign In for Pricing
View Details
Nori® Canine 2-Plex ELISA Kits-PTX3/AGP
GR226177 96 Well

Nori® Canine 2-Plex ELISA Kits-PTX3/AGP

Sign In for Pricing
View Details
FGFR1 Rabbit Polyclonal Antibody (RBITC)
orb1054516 100 µL

FGFR1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details