Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SOX5 Antibody Picoband®
PB9507 100 µg/Vial

Anti-SOX5 Antibody Picoband®

Sign In for Pricing
View Details
C1S Antibody
orb677133 100 µL

C1S Antibody

Sign In for Pricing
View Details
C16orf73 antibody
70R-4561 100 µL

C16orf73 antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
orb2920639-01 20 µg

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
orb2920639-02 100 µg

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)

Sign In for Pricing
View Details
CA19-9 Mouse mAb, BF405 conjugated
orb3000514 100 µL

CA19-9 Mouse mAb, BF405 conjugated

Sign In for Pricing
View Details