Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choriogonadotropin subunit beta 7 (CGB7), Biotinylated

This Recombinant Human Choriogonadotropin subunit beta 7 (CGB7), Biotinylated spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choriogonadotropin subunit beta 7 CGB7

UniProt

P0DN87

Expression Region

21-165

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS1 Blocking Peptide
MBS824401-01 1 mg

NDUFS1 Blocking Peptide

Sign In for Pricing
View Details
NDUFS1 Blocking Peptide
MBS824401-02 5 mg

NDUFS1 Blocking Peptide

Sign In for Pricing
View Details
NDUFS1 Blocking Peptide
MBS824401-03 5x 5 mg

NDUFS1 Blocking Peptide

Sign In for Pricing
View Details
L3MBTL3 Human Recombinant Protein
TP725860 50 µg

L3MBTL3 Human Recombinant Protein

Sign In for Pricing
View Details
Mouse anti HLA-DR Monoclonal Antibody
MBS460914-01 0.1 mg

Mouse anti HLA-DR Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti HLA-DR Monoclonal Antibody
MBS460914-02 5x 0.1 mg

Mouse anti HLA-DR Monoclonal Antibody

Sign In for Pricing
View Details