Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1), Biotinylated

This Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1), Biotinylated spans the amino acid sequence from region 1-449. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin gamma-1 heavy chain; Immunoglobulin gamma-1 heavy chain NIE

UniProt

P0DOX5

Expression Region

1-449

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYNGNNKHYADSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC39B Antibody
A57311-50UL 50 μL

TTC39B Antibody

Sign In for Pricing
View Details
Prkx Rat shRNA Plasmid (Locus ID 501563)
TL703261 1 Kit

Prkx Rat shRNA Plasmid (Locus ID 501563)

Sign In for Pricing
View Details
Cmtm2b Mouse shRNA Plasmid (Locus ID 75502)
TR505068 1 Kit

Cmtm2b Mouse shRNA Plasmid (Locus ID 75502)

Sign In for Pricing
View Details
2,4-Dimethoxypyridine 98+% (TLC)
230917-01 250 mg

2,4-Dimethoxypyridine 98+% (TLC)

Sign In for Pricing
View Details
2,4-Dimethoxypyridine 98+% (TLC)
230917-02 1 g

2,4-Dimethoxypyridine 98+% (TLC)

Sign In for Pricing
View Details
2,4-Dimethoxypyridine 98+% (TLC)
230917-03 5 g

2,4-Dimethoxypyridine 98+% (TLC)

Sign In for Pricing
View Details