Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chka activation kit by CRISPRa
GA200719 1 Kit

Mouse Chka activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF594 conjugate, 0.1mg/mL
BNC942730-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL
BNUM1547-50 1x 50 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL

Sign In for Pricing
View Details
B-(2-Oxo-2H-1-benzopyran-7-yl)boronic Acid
TRC-O869820-50MG 50 mg

B-(2-Oxo-2H-1-benzopyran-7-yl)boronic Acid

Sign In for Pricing
View Details
3,4-Diaminobenzophenone
TRC-D416100-5G 5 g

3,4-Diaminobenzophenone

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF568 conjugate, 0.1mg/mL
BNC681952-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details