Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorprothixene-d6 Hydrochloride
TRC-C424852-1MG 1 mg

Chlorprothixene-d6 Hydrochloride

Sign In for Pricing
View Details
3-Acetoxy Bromazepam
TRC-A164400-2MG 2 mg

3-Acetoxy Bromazepam

Sign In for Pricing
View Details
Mouse Cat activation kit by CRISPRa
GA200531 1 Kit

Mouse Cat activation kit by CRISPRa

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Coated Plate
X016-1EA 1 Each

Goat anti-Rabbit IgG Coated Plate

Sign In for Pricing
View Details
Human KRTAP2-2 activation kit by CRISPRa
GA118923 1 Kit

Human KRTAP2-2 activation kit by CRISPRa

Sign In for Pricing
View Details
C-Kit Antibody
KC-3413-01 50 μL

C-Kit Antibody

Sign In for Pricing
View Details