Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SCARB3 Protein (His Tag)
PKSH031413-01 50 µg

Recombinant Human SCARB3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SCARB3 Protein (His Tag)
PKSH031413-02 500 µg

Recombinant Human SCARB3 Protein (His Tag)

Sign In for Pricing
View Details
N-Benzylbenzamide
TRC-B130198-50MG 50 mg

N-Benzylbenzamide

Sign In for Pricing
View Details
APC Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273E-01 20 Tests

APC Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details
APC Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273E-02 100 Tests

APC Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details
APC Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273E-03 2x 100 Tests

APC Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details