Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tmem42 shRNA (UAS) - Lentiviral mouse Tmem42 shRNA (UAS, GFP) (100)
GTR15220653 1 Vial

Lentiviral mouse Tmem42 shRNA (UAS) - Lentiviral mouse Tmem42 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-Human HLA-B Polyclonal Antibody
PHB96301 100 μg

Anti-Human HLA-B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PF4 Antibody Picoband® (Dylight594 Conjugate)
A00871-Dylight594 100 µg

Anti-PF4 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Vu 0225035
RG-P022528-01 10 mg

Vu 0225035

Sign In for Pricing
View Details
Vu 0225035
RG-P022528-02 25 mg

Vu 0225035

Sign In for Pricing
View Details
Vu 0225035
RG-P022528-03 50 mg

Vu 0225035

Sign In for Pricing
View Details